PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g021486m
Common NameCISIN_1g021486mg, LOC102615096
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB
Protein Properties Length: 313aa    MW: 34480.8 Da    PI: 7.1157
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g021486mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.2e-161461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+W +eEde+lv+++k+ G g+W++ ++  g+ R++k+c++rw +yl
  orange1.1g021486m 14 KGPWAPEEDEILVEYIKRNGHGSWRSLPKLAGLLRCGKSCRLRWTNYL 61
                       79******************************99************97 PP

2Myb_DNA-binding50.25.8e-1667112148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg++T+eE++l ++++  lG++ W++Ia+ ++ gRt++++k+ w+++l
  orange1.1g021486m  67 RGPFTEEEEKLVIQLHGILGNR-WAAIASQLP-GRTDNEIKNLWNTHL 112
                        89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.13961IPR017930Myb domain
SuperFamilySSF466891.27E-2911108IPR009057Homeodomain-like
SMARTSM007173.6E-121363IPR001005SANT/Myb domain
PfamPF002491.2E-141461IPR001005SANT/Myb domain
CDDcd001671.46E-91661No hitNo description
PROSITE profilePS5129425.32662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-2665116IPR009057Homeodomain-like
SMARTSM007173.7E-1566114IPR001005SANT/Myb domain
PfamPF002495.8E-1567112IPR001005SANT/Myb domain
CDDcd001671.65E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRTPCCDKK GLKKGPWAPE EDEILVEYIK RNGHGSWRSL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF TEEEEKLVIQ LHGILGNRWA AIASQLPGRT DNEIKNLWNT HLKKRMLLMG  120
LDPQTHEPFS SSGPAIKAPA TPTTRHMAQW ESARLEAEAR LSRESLLFNT PSMGKTDSDH  180
FLRMWNSEVG ESFRKFNKGV KTACQSPNSQ VSSSTKCGSV SAVSTEIGHN LAGSSATPSN  240
QNEDTECKSS KSCTEDMVAG SDTSSSNDLQ DSSDSSLQLL LDFPINNDMS FLEDNYFASS  300
AMFTGDSLIC PL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006445088.10.0hypothetical protein CICLE_v10021268mg
RefseqXP_006491064.10.0PREDICTED: transcription repressor MYB6
TrEMBLA0A067H2J70.0A0A067H2J7_CITSI; Uncharacterized protein
TrEMBLV4TDD20.0V4TDD2_9R
STRINGPOPTR_0014s07700.11e-173(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69822643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-124myb domain protein 17